PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc02642.1.g00090.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 257aa    MW: 29172.3 Da    PI: 6.4261
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc02642.1.g00090.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding383.8e-12440138
                                  TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HH CS
               Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlk 38
                                  rg W + Ede+l+++v+++G+++W++Ia++++ gR++ 
  Zmw_sc02642.1.g00090.1.am.mk  4 RGHWRPSEDEKLKELVALYGPHNWNAIAEKLQ-GRSAQ 40
                                  899*****************************.**986 PP

2Myb_DNA-binding52.31.3e-1677120146
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                   r ++++eE+ell+  ++ +G++ W+ Iar ++ gRt++ +k++w+ 
  Zmw_sc02642.1.g00090.1.am.mk  77 RSPFSEEEEELLLASHRVHGNR-WAVIARLFP-GRTDNAVKNHWHV 120
                                   789*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.216153IPR017930Myb domain
SMARTSM007171.6E-7373IPR001005SANT/Myb domain
PfamPF002493.1E-11440IPR001005SANT/Myb domain
SuperFamilySSF466891.12E-224118IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.9E-24578IPR009057Homeodomain-like
CDDcd001677.85E-10769No hitNo description
PROSITE profilePS5129424.46472126IPR017930Myb domain
SMARTSM007174.5E-1576124IPR001005SANT/Myb domain
PfamPF002497.7E-1477119IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.4E-2079125IPR009057Homeodomain-like
CDDcd001677.54E-692119No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 257 aa     Download sequence    Send to blast
MCTRGHWRPS EDEKLKELVA LYGPHNWNAI AEKLQGRSAQ AMESYHGVIN KELIEEFVSG  60
KSCRLRWFNQ LDPRINRSPF SEEEEELLLA SHRVHGNRWA VIARLFPGRT DNAVKNHWHV  120
IMARRCRERT RMANKRCGTA AGSAIENDSN PRSAKKDRPD VANSMASLLD KYRSEVTGPF  180
AIGHDSMEGY RSTTNEDMTT DKSVEFYDFL QVNANSSDTK WGSSIEEQDE NRADDDQAEG  240
GQVPFIDFLK VGASHGQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-2821265108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008644562.11e-122PREDICTED: transcriptional activator Myb-like isoform X4
TrEMBLA0A060D7S31e-121A0A060D7S3_MAIZE; MYB transcription factor (Fragment)
STRINGGRMZM2G455869_P011e-121(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29438260